Jun 20, 2025

Zika NS2B-NS3 protease co-expression construct small scale expression and purification protocol V.2

Forked from a private protocol
  • 1Centre for Medicines Discovery, University of Oxford, ASAP Discovery Consortium
  • ASAP Discovery
Icon indicating open access to content
QR code linking to this content
Protocol CitationKorvus Wang, Michael Fairhead, Eleanor Williams 2025. Zika NS2B-NS3 protease co-expression construct small scale expression and purification protocol. protocols.io https://dx.doi.org/10.17504/protocols.io.3byl49mrrgo5/v2Version created by Mary-Ann Xavier
License: This is an open access  protocol  distributed under the terms of the  Creative Commons Attribution License,  which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited
Protocol status: Working
We use this protocol and it's working
Created: June 20, 2025
Last Modified: June 20, 2025
Protocol  Integer ID: 220632
Keywords: expression, purification, ASAP, CMD, AViDD, NS3 protease, Zika Virus, Zika Virus NS3 protease, NS2B-NS3, purification of zika ns2b, ns3 protease coexpression construct, zika ns2b, purification protocol this protocol, purification protocol, purification, addgene id
Funders Acknowledgements:
National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)
Grant ID: U19AI171432
Disclaimer
Research was supported in part by NIAID of the U.S National Institutes of Health under award number U19AI171399. The content is solely the responsibility of the authors and does not necessarily represent the official views of the National Institutes of Health.
Abstract
This protocol details the co-expression and purification of Zika NS2B-NS3 protease coexpression construct bearing a N-terminal His-GST tag at small scale (<6L). In this new version, we added the Addgene id.
Attachments
Guidelines
  • Construct / plasmid resource-name: ZVNS2B-NS3 protease co-expression construct bearing a N-terminal His-GST tag.
Materials
Plasmid details:

  • Vector: pNIC
  • Cell line: E. coli Rosetta strain BL21(DE3)-RR
  • Tags and additions: N-terminal His- tag
  • Construct protein sequence: ` MHHHHHHSSMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSGGGSENLYFQSMGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEE

Expression
TB media, 1mM IPTG

Purification
Chicken hen egg white lysozyme
Benzonase
Imidazole
Ni Sepharose 6 FF resin
Gravity flow column, 2.5cm diameter
Centrifugal concentrators, 10kDa MWCO

On an FPLC system:
Cytiva HiLoad 16/600 Superdex 75 pg
5mL sample loop

SDS-PAGE sample buffer, gel, and gel tank

Lysis buffer:

AB
Hepes (pH 7.5)50 mM
NaCl500 mM
Glycerol5%
TCEP1 mM
Lysozyme0.5 mg/mL
Benzonase0.05 mg/mL
Prepare 100L per 1L E.coli expression


Base buffer:
AB
Hepes (pH 7.5)50 mM
NaCl50 mM
Glycerol5%
TCEP1 mM
Prepare 2L per 6L E.coli expression. Used to prepare the following buffers
Binding buffer: base buffer
Wash buffer 1: base buffer + 1:2000 benzonase + 2mM MgCl2
Wash buffer 2: base buffer + 30mM imidazole
Elution buffer: base buffer, add 500mM imidazole
rIMAC wash buffer: base buffer + 50mM imidazole
Gel filtration buffer: base buffer + 20mM imidazole


SDS-PAGE gel: NuPage 4-12%, Bis-Tris protein gel, 27 well.
Run in MES buffer, 200V 35mins.







Protocol materials
Zika virus portion of NS2B protease coexpressed with NS3 proteaseaddgeneCatalog #228663
Abbreviations
CV - column volume, total volume of resin in a column
IMAC - immobilised metal affinity chromatography
FT - flow through
ZVNS2B3 - Zika NS2B-NS3 protease
Plasmid Transformation
1d
ZVNS2B3 N-terminal His-GST tagged co-expression construct was inoculated from its BL21(DE3)-RR glycerol stock. Zika virus portion of NS2B protease coexpressed with NS3 proteaseaddgeneCatalog #228663

Note
The ZVNS2B-NS3 co-expression construct encodes the NS2B and NS3 protease with a N-terminal His-GST tag fusion on a kanamycin resistant plasmid backbone with a T7 promoter.

Protein expression
2d 10h
Scrape off some of the glycerol stock with a sterile loop and use this to inoculate a 50 mL falcon tube containing 10 mL of LB supplemented with 50 Mass Percent kanamycin. Grow the starter culture at 37 °C Overnight with 200 rpm shaking.
4h
Use 10 mL starter culture to inoculate every 1 L TB media (see Materials) supplemented with 50 Mass Percent kanamycin in a baffled flask. 200 rpm, 37°C

Note
For this protocol 2L of pellet was grown for purification


6h
When the OD600 approximately 1.8, add 1mM IPTG. Lower the temperature and shaker speed to 180 rpm, 18°C . Incubate overnight.

1d
Harvest the cell by centrifugation at 4000 x g, 4°C, 00:30:00 . Discard supernatant and store pellet by freezing at -80 °C .
Note
For reference: total pellet weight from 2L TB media was 33g


30m
Protein Purifcation
2d
Lyse cell pellet
2h 30m
Note
See Materials tab for buffer compositions.


Note
ZV NS2B-NS3 His-GST fusion protein properties

Before tag cleavage:
MW = 32812.5 Da
E (assume all Cys reduced)= 51340 mM-1cm-1
PI = 5.47

After tag cleavage:
NS2B
MW = 5063.51 Da
E(assume all Cys reduced) = 6990
PI = 3.98

NS3
MW = 18095.66 kDa
E(assume all Cys reduced) = 30940
PI = 6.73

These values are determined by Expasy ProtParam


Thaw and resuspend the pellet in ~7mL of lysis buffer per g of pellet. Stir gently with magnetic stir bar at Room temperature for 00:30:00 to allow lysozyme and bezonase to start breaking down
cell components.
1h
Lyse by sonication 00:00:04 On 00:00:12 Off for a total 'on' time of 00:07:00 at 50% amplitude to fully rupture the cells. Ensure pellet is 0 °C during sonication to prevent overheating.
30m
Centrifuge the lysed cells for 38000 x g, 4°C, 01:00:00 to remove insoluble cell debris, and collect supernatant in a bottle 4 °C
1h
Perform IMAC to extract target protein from the lysed cell mixture
Dispense 3 mL Nickle affinity resin Ni Sepharose 6 FF - Cytiva into a gravity flow column. Equilibrate resin by first rinsing with ~ 10 µL distilled water, then ~ 10 µL binding buffer to remove the storage solution.
10m
Resuspend the equilibrated resin with some binding buffer and add to the supernatant bottle. Incubate the resin with the supernatant for 00:30:00 while rotating or otherwise mixing gently at 4 °C
30m
Load the resin/supernatant mix back onto the gravity flow column, retaining the FT separately for SDS-PAGE analysis.

Note
For SDS-PAGE samples, mix 15uL sample with 5uL 4x sample buffer, supplemented with 10mM DTT.

30m
Wash the column with 10 µL of base buffer, followed by 10 µL of wash buffer 1. Incubate for 10 minutes. This is to digest any DNA that might have bound to the resin.
30m
Allow wash buffer 1 to drain. Wash resin with 10 µL of wash buffer 2. This is to remove non-specific, weak binding of contaminant proteins from the resin for a cleaner elution.
Collect washes separately for SDS-PAGE analysis.
Elute the protein with 2.5 µL of elution buffer.
20m
Repeat step 8.6 one more time, collecting a total of 2 separate elution fractions. This is to ensure maximum retrieval of protein from the resin.

Measure the total protein concentration of the elutions by Nanodrop. Although still a mixture, A280 value can give an estimate of the protein content, which will determine how much protease need to be added to remove the affinity tag.
20m
Wash used IMAC resin with 10CV of base buffer, and leave in the column submerged in a small amount of base buffer such that the resin is kept moist.
This washed IMAC resin will later be reused for reverse IMAC (rIMAC)
Run SDS-PAGE of all samples from total lysis supernatant to final elution. Stain gel with protein staining solution Coomasssie Blue and determine which fractions contain the target protein by finding the band corresponding to the target molecular weight.

Note
The target protein is expected to be present mostly in the elution samples, although small amounts may be found in the FT and washes.
If that is not the case, then further troubleshooting is required.

40m
Elution de-salting, tag cleavage and reverse IMAC
1d
Pool and desalt the two elutions using HiPrep 26/10 deasalting columns, run on AKTA pure at the maximum flow rate of 10mL/min.
Note
Sample can be injected into the desalting column using a Cytiva Superloop or sample pump.


Note
This is to reduce imidazole concentration in the sample. High concentration of imidazole will inhibit protease activity during tag cleavage and removal.

30m
For tag removal, His-TEV was added in 1:100 ratio to the total protein content of the desalted sample, as determined by nanodrop. The mixture was left in the cold room at 4 °C Overnight

1d
In morning, pour the cleavage mixture over the washed resin three times and collect final FT.

Note
This step will remove the cleaved tag and any uncleaved target from the sample. If the protease used is His-tagged, then the protease is removed from sample too.


30m
Wash rIMAC resin with 2 µL rIMAC wash buffer to remove any target protein still bound to the resin.
Take samples of the FT and wash, characterise content by SDS-PAGE

SDS-PAGE analysis of IMAC and cleavage fractions. The band highlighted by red arrow agrees with the size of the cleaved NS3 construct (18095.66 kDa)



30m
(Optional) elute rIMAC resin with 2 µL elution buffer to confirm if the protein shows non-specific binding to the resin used.

Note
This will help determine if the protein is "sticky" to the Ni resin matrix material, and help in further troubleshooting if the final yield is lower than expected.



5m
Purify sample further by size exclusion chromatography.
6h
Using 10,000 MWCO spin concentrators, concentrate the rIMAC step containing fractions of the target protein to a final volume of under 5 mL .

1h
Remove any solid aggregates from the sample by centrifugation at 17200 x g, 4°C, 00:10:00 , then immediately draw up the supernatant with a 5mL syringe and a blunt-tip fill needle, taking care not to disturb the pellet.

Note
This is to remove as much solid particles from the injection sample as possible, so as to not clog the in-line filter or frit of the column.


15m
Using the AKTA Pure system:

Inject the sample onto a 5mL sample loop.

Run the sample down HiLoad 16/60 Superdex 75 pg gel filtration column at 1mL/min in gel filtration buffer, collecting 1mL aliquots.
2h
From the chromatogram, fraction F9-H8 analyse by SDS-PAGE.


SDS-PAGE analysis of SEC fraction 2D7-3B7. Fractions 2F7-H1 were pooled as they contain majority target protein in comparison to contaminants.

1h
Take the fractions that contain the target protein, which in this case are fraction E10-F4. Concentrate the final sample in Vivaspin 500 10kda MWCO centrifugal concentrator until the concentration reaches >23 mg/mL or 1 millimolar (mM) .

Take 1 µL of the final sample for SDS-PAGE(result not shown here), and another for mass spectroscopy (MS).


Intact MS of the final protein sample. The main deconvoluted mass, 5069 Da and 18096 Da, agrees with the size of the cleaved NS2B and NS3 construct.

30m
Aliquot into appropriate volumes for future usage to minimise freeze/thaw cycles. Flash-freeze in liquid nitrogen, and store at -80 °C until required.


10m