Jun 04, 2025
Version 3
West Nile virus NS2B-NS3 protease fusion construct small scale expression and purification protocol V.3
Version 1 is forked from Zika NS2B-NS3 fusion construct for assay small scale expression and purification protocol
- 1Centre for Medicines Discovery, University of Oxford, ASAP Discovery Consortium
- ASAP Discovery
Protocol Citation: Korvus Wang, Michael Fairhead, Eleanor Williams 2025. West Nile virus NS2B-NS3 protease fusion construct small scale expression and purification protocol. protocols.io https://dx.doi.org/10.17504/protocols.io.261ge5rrwg47/v3Version created by Mary-Ann Xavier
License: This is an open access protocol distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited
Protocol status: Working
We use this protocol and it's working
Created: June 04, 2025
Last Modified: June 04, 2025
Protocol Integer ID: 219560
Keywords: expression, purification, ASAP, CMD, AViDD, WNV, West Nile Virus, NS2B-NS3 protease, purification of west nile virus ns2b, west nile virus ns2b, ns3 protease fusion, ns3 protease fusion construct, ns3 protease, west nile, purification, purification protocol, purification protocol this protocol, addgene id, protease
Funders Acknowledgements:
National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)
Grant ID: U19AI171432
Disclaimer
Research was supported in part by NIAID of the U.S National Institutes of Health under award number U19AI171399. The content is solely the responsibility of the authors and does not necessarily represent the official views of the National Institutes of Health.
Abstract
This protocol details the co-expression and purification of West Nile virus NS2B-NS3 protease fusion construct bearing a N-terminal His-StrepII tag at small scale (<6L). This protocol produces enzymatically active product that is suitable for biochemical assays. In this version we added the Addgene id.
Attachments
Guidelines
- Construct / plasmid resource-name: WNV NS2BNS3 protease fusion construct bearing TEV-cleavable N-terminal His-StrepII tag.
Materials
Plasmid details:
The construct used was internal id (QQ01WNVNS2B-c003).
- Vector: pNIC
- Cell line: E. coli Rosetta strain BL21(DE3)-RR
- Tags and additions: N-terminal His-StrepII tag
- Construct protein sequence: ` MHHHHHHSSGASWSHPQFEKGGGSGGGSGGSAWSHPQFEKGSGVDLGTENLYFQSMSTDMWIERTADISWESDAEITGSSERVDVRLDDDGNFQLMNDPGAPWAGGGGSGGGGGVLWDTPSPKEYKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWKLQHKWNGQDEVQMIVVEPGKNVKNVQTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMDEPIPAGFEPEMLRKK
Expression
TB media, 1mM IPTG
Purification
Chicken hen egg white lysozyme
Benzonase
Imidazole
Ni Sepharose 6 FF resin
Gravity flow column, 2.5cm diameter
Centrifugal concentrators, 10kDa MWCO
Thermo Slide-A-Lyzer Dialysis Cassette, 3.5kDa 15mL (or equivalent snakeskin tubing)
On an FPLC system:
Cytiva HiLoad 16/600 Superdex 75 pg
5mL sample loop
SDS-PAGE sample buffer, gel, and gel tank
Lysis buffer:
| A | B | |
| Hepes (pH 7.5) | 50 mM | |
| NaCl | 500 mM | |
| Glycerol | 5% | |
| TCEP | 1 mM | |
| Lysozyme | 0.5 mg/mL | |
| Benzonase | 0.05 mg/mL |
Prepare 100L per 1L E.coli expression
Base buffer:
| A | B | |
| Hepes (pH 7.5) | 50 mM | |
| NaCl | 50 mM | |
| Glycerol | 5% | |
| TCEP | 1 mM |
Prepare 2L per 6L E.coli expression. Used to prepare the following buffers
Binding buffer: base buffer + 20mM imidazole
Wash buffer 1: base buffer + 30mM imidazole
Elution buffer: base buffer, add 200mM imidazole
Gel filtration buffer: base buffer
SDS-PAGE gel: NuPage 4-12%, Bis-Tris protein gel, 27 well.
Run in MES buffer, 200V 35mins.
Protocol materials
WNV NY99 NS2B-NS3 protease fusion (non-cleavable linker) K→A mutation anti-autoproteolysisaddgeneCatalog #228660
Abbreviations
CV - column volume, total volume of resin in a column
IMAC - immobilised metal affinity chromatography
FT - flow through
WNVNS2B3 - WNV NS2B-NS3 protease
Plasmid Transformation
1d
The plasmid encodes WNVNS2B and NS3 protease with a non-cleavable flexible linker and a N-terminal His6-StrepII tag fusion. WNV NY99 NS2B-NS3 protease fusion (non-cleavable linker) K→A mutation anti-autoproteolysisaddgeneCatalog #228660 Pre-culture was inoculated from its BL21(DE3)-RR glycerol stock.
Note
The WNV NS2B-NS3 fusion construct encodes the NS2B and NS3 protease with a N-terminal His6-StrepII tag fusion on a kanamycin resistant plasmid backbone with a T7 promoter.
Protein expression
2d 10h
Scrape off some of the glycerol stock with a sterile loop and use this to inoculate a 50 mL falcon tube containing 10 mL of LB supplemented with 50 Mass Percent kanamycin. Grow the starter culture at 37 °C Overnight with 200 rpm shaking.
4h
Use 10 mL starter culture to inoculate every 1 L TB media (see Materials) supplemented with 50 Mass Percent kanamycin in a baffled flask. 200 rpm, 37°C
6h
When the OD600 approximately 1.8, add 1 millimolar (mM) IPTG. Lower the temperature and shaker speed to 180 rpm, 18°C . Incubate overnight.
1d
Harvest the cell by centrifugation at 4000 x g, 4°C, 00:30:00 . Discard supernatant and store pellet by freezing at -80 °C .
30m
Protein Purifcation
2d
Lyse cell pellet
2h 30m
Note
See Materials tab for buffer compositions.
The expression scale for this protocol is 2L.
Note
WNV NS2B-NS3 His6-StrepII fusion protein properties
Before tag cleavage:
MW = 32038.6 Da
E (assume all Cys reduced)= 66920 mM-1cm-1
PI = 5.34
After tag cleavage:
MW = 26344.5 Da
E (assume all Cys reduced)= 54430 mM-1cm-1
PI = 4.83
These values are determined by Expasy ProtParam
Thaw and resuspend the pellet in ~7mL of lysis buffer per g of pellet. Stir gently with magnetic stir bar at Room temperature for 00:30:00 to allow lysozyme and bezonase to start breaking down
cell components.
1h
Lyse by sonication 00:00:05 On 00:00:10 Off for a total 'on' time of 00:15:00 at 50% amplitude to fully rupture the cells. Ensure pellet is 0 °C during sonication to prevent overheating.
45m
Centrifuge the lysed cells for 38000 x g, 4°C, 01:00:00 to remove insoluble cell debris, and collect supernatant in a bottle 4 °C
1h
Perform IMAC to extract target protein from the lysed cell mixture
Dispense 8 mL Nickle affinity resin Ni Sepharose 6 FF - Cytiva into a gravity flow column. Equilibrate resin by first rinsing with ~ 10 µL distilled water, then ~ 10 µL binding buffer to remove the storage solution.
10m
Resuspend the equilibrated resin with some binding buffer and add to the supernatant bottle. Incubate the resin with the supernatant for 00:30:00 while rotating or otherwise mixing gently at 4 °C
30m
Load the resin/supernatant mix back onto the gravity flow column, retaining the FT separately for SDS-PAGE analysis.
Note
For SDS-PAGE samples, mix 15uL sample with 5uL 4x sample buffer, supplemented with 10mM DTT.
30m
Wash the column with 10 µL of base buffer, followed by 10 µL of wash buffer twice. Allow wash buffer to pass through completely between washes. This is to remove non-specific, weak binding of contaminant proteins from the resin for a cleaner elution.
Collect washes separately for SDS-PAGE analysis.
30m
Elute the protein with 2.5 µL of elution buffer, incubate on resin for 00:10:00 before eluting.
10m
Repeat step 8.5 two more times, collecting a total of 3 separate elution fractions. This is to ensure maximum retrieval of protein from the resin.
Measure the total protein concentration of the elutions by Nanodrop. Although still a mixture, A280 value can give an estimate of the protein content, which will determine how much protease need to be added to remove the affinity tag.
20m
Wash used IMAC resin with 10CV of base buffer, and leave in the column submerged in a small amount of base buffer such that the resin is kept moist.
This washed IMAC resin will later be reused for reverse IMAC (rIMAC)
Run SDS-PAGE of all samples from total lysis supernatant to final elution. Stain gel with protein staining solution Coomasssie Blue and determine which fractions contain the target protein by finding the band corresponding to the target molecular weight.
Note
The target protein is expected to be present mostly in the elution samples, although small amounts may be found in the FT and washes.
If that is not the case, then further troubleshooting is required.
40m
Elution de-salting, tag cleavage and reverse IMAC
1d
Pool and desalt the two elutions by dialysis, using Thermo Slide-A-Lyzer Dialysis Cassette, 3.5kDa 15mL (or equivalent), into 4L of base buffer.
Note
This is to reduce imidazole concentration in the sample. High concentration of imidazole will inhibit protease activity during tag cleavage and removal.
Dialysis cassettes were used due to equipment availability. Dialysis using snake skin tubing or desalting using pre-packed columns are also acceptable.
30m
For tag removal, His-TEV was added in 1:20 ratio to the total protein content of the dialysis sample, as determined by nanodrop. The mixture was left in the cold room at 4 °C Overnight
1d
In morning, pour the cleavage mixture over the washed resin three times and collect final FT.
Note
This step will remove the cleaved tag and any uncleaved target from the sample. If the protease used is His-tagged, then the protease is removed from sample too.
30m
Wash rIMAC resin with 2 µL wash buffer 1 and 2 to remove any target protein still bound to the resin.
Take samples of the FT and wash, characterise content by SDS-PAGE
SDS-PAGE analysis of IMAC and cleavage fractions. The major band in rIMAC FT agrees with the size of the cleaved fusion construct (26.345 kDa) The gel on the left contains sample taken from IMAC, and the right contains samples from rIMAC. In rIMAC, cleaved target protein is also present in the wash and elution 1 fractions. One possible cause is that the target is "sticky" and contains some intrinsic affinity for the resin used.
30m
(Optional) elute rIMAC resin with 2 µL elution buffer to confirm if the protein shows non-specific binding to the resin used.
Note
This will help determine if the protein is "sticky" to the Ni resin matrix material, and help in further troubleshooting if the final yield is lower than expected.
5m
Purify sample further by size exclusion chromatography.
6h
Using 10,000 MWCO spin concentrators, concentrate the rIMAC step containing fractions of the target protein to a final volume of under 5 mL .
1h
Remove any solid aggregates from the sample by centrifugation at 17200 x g, 4°C, 00:10:00 , then immediately draw up the supernatant with a 5mL syringe and a blunt-tip fill needle, taking care not to disturb the pellet.
Note
This is to remove as much solid particles from the injection sample as possible, so as to not clog the in-line filter or frit of the column.
Sample can also be passed through a 0.22 micron syringe filter instead.
15m
Using the AKTA Pure system:
Inject the sample onto a 5mL sample loop.
Run the sample down HiLoad 16/60 Superdex 75 pg gel filtration column at 1mL/min in gel filtration buffer, collecting 1mL aliquots.
2h
From the chromatogram, fraction E10-G2 were analysed by SDS-PAGE.
Chromatogram of the WNV NS2B3 fusion construct SEC run. Fractions D9, E4, E9-G2 were analyzed by SDS-PAGE to see which contained the target protein.
SDS-PAGE analysis of SEC fraction D9, E4, E9-G2. Fraction E10-G2 were pooled as they contain majority target protein in comparison to contaminants.
1h
Take the fractions that contain the target protein, which in this case are fraction E10-G2. Concentrate the final sample in Vivaspin 500 10kda MWCO centrifugal concentrator until the concentration reaches approximately 10 mg/mL .
Take 1 µL of the final sample for SDS-PAGE (result not shown here), and another 1 µL for mass spectroscopy (MS) analysis. (result not shown here)
30m
Aliquot into appropriate volumes for future usage to minimise freeze/thaw cycles. Flash-freeze in liquid nitrogen, and store at -80 °C until required.
10m